ARG40779
anti-TRPM3 antibody
anti-TRPM3 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes TRPM3 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | TRPM3 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human TRPM3. (Within the following region: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD) |
| Conjugation | Un-conjugated |
| Alternate Names | Transient receptor potential cation channel subfamily M member 3; LTrpC3; GON-2; Melastatin-2; LTRPC3; MLSN2; LTrpC-3; Long transient receptor potential channel 3 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | HepG2 |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q9HCF6 Human Transient receptor potential cation channel subfamily M member 3 |
|---|---|
| Gene Symbol | TRPM3 |
| Gene Full Name | transient receptor potential cation channel, subfamily M, member 3 |
| Background | The product of this gene belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Function | Calcium channel mediating constitutive calcium ion entry. Its activity is increased by reduction in extracellular osmolarity, by store depletion and muscarinic receptor activation. [UniProt] |
| Cellular Localization | Membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 198 kDa |
Images (1) Click the Picture to Zoom In
-
ARG40779 anti-TRPM3 antibody WB image
Western blot: HepG2 cell lysate stained with ARG40779 anti-TRPM3 antibody at 1.25 µg/ml dilution.
