ARG59130
anti-SP2 antibody
anti-SP2 antibody for Western blot and Human,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes SP2 |
---|---|
Tested Reactivity | Hu, Rat |
Predict Reactivity | Hm |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | SP2 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to aa. 312-343 of Human SP2. (QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ) |
Conjugation | Un-conjugated |
Alternate Names | Transcription factor Sp2 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
Preservative | 0.05% Sodium azide |
Stabilizer | 5% BSA |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | SP2 |
Gene Full Name | Sp2 transcription factor |
Background | This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters. [provided by RefSeq, Jul 2008] |
Function | Binds to GC box promoters elements and selectively activates mRNA synthesis from genes that contain functional recognition sites. [UniProt] |
Cellular Localization | Nucleus. [UniProt] |
Calculated MW | 65 kDa |
Images (1) Click the Picture to Zoom In