ARG59204
anti-Regucalcin antibody
anti-Regucalcin antibody for IHC-Formalin-fixed paraffin-embedded sections and Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Regucalcin |
|---|---|
| Tested Reactivity | Ms, Rat |
| Tested Application | IHC-P |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Regucalcin |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human Regucalcin. (YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD) |
| Conjugation | Un-conjugated |
| Alternate Names | EC 3.1.1.17; Senescence marker protein 30; Gluconolactonase; Regucalcin; HEL-S-41; SMP-30; SMP30; RC; GNL |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | RGN |
| Gene Full Name | regucalcin |
| Background | The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
| Function | Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities (By similarity). [UniProt] |
| Cellular Localization | Cytoplasm. [UniProt] |
| Calculated MW | 33 kDa |
Images (3) Click the Picture to Zoom In
-
ARG59204 anti-Regucalcin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse liver tissue. Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59204 anti-Regucalcin antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG59204 anti-Regucalcin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat kidney tissue. Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59204 anti-Regucalcin antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG59204 anti-Regucalcin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat liver tissue. Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59204 anti-Regucalcin antibody at 1 µg/ml dilution, overnight at 4°C.
