ARG59245

anti-PREB antibody

anti-PREB antibody for Western blot and Mouse

Overview

Product Description Rabbit Polyclonal antibody recognizes PREB
Tested Reactivity Ms
Predict Reactivity Hu, Rat, Cow, Dog, Gpig, Hrs, Pig, Rb, Zfsh
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name PREB
Antigen Species Mouse
Immunogen Synthetic peptide around the N-terminal region of Mouse PREB. (within the following region: RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL)
Conjugation Un-conjugated
Alternate Names Prolactin regulatory element-binding protein; SEC12; Mammalian guanine nucleotide exchange factor mSec12

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Application Suggestion
Tested Application Dilution
WB1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 45 kDa

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 50907 Mouse PREB

Swiss-port # Q9WUQ2 Mouse Prolactin regulatory element-binding protein

Gene Symbol PREB
Gene Full Name prolactin regulatory element binding
Background This gene encodes a protein that specifically binds to a Pit1-binding element of the prolactin (PRL) promoter. This protein may act as a transcriptional regulator and is thought to be involved in some of the developmental abnormalities observed in patients with partial trisomy 2p. This gene overlaps the abhydrolase domain containing 1 (ABHD1) gene on the opposite strand. [provided by RefSeq, Jul 2008]
Function Was first identified based on its probable role in the regulation of pituitary gene transcription. Binds to the prolactin gene (PRL) promoter and seems to activate transcription (By similarity). Guanine nucleotide exchange factor that activates SARA2. Required for the formation of COPII transport vesicles from the ER. [UniProt]
Cellular Localization Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus. Note=Concentrates at endoplasmic reticulum exit sites. [UniProt]
Calculated MW 45 kDa

Images (1) Click the Picture to Zoom In

  • ARG59245 anti-PREB antibody WB image

    Western blot: Mouse liver lysate stained with ARG59245 anti-PREB antibody at 1.0 µg/ml dilution.