ARG40423
anti-MYBPC2 antibody
anti-MYBPC2 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MYBPC2 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MYBPC2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human MYBPC2. (within the following region: KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT) |
| Conjugation | Un-conjugated |
| Alternate Names | MYBPCF; C-protein, skeletal muscle fast isoform; Fast MyBP-C; MYBPC; Myosin-binding protein C, fast-type |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 85%; Mouse: 100%; Rat: 93% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q14324 Human Myosin-binding protein C, fast-type |
|---|---|
| Gene Symbol | MYBPC2 |
| Gene Full Name | myosin binding protein C, fast type |
| Background | This gene encodes a member of the myosin-binding protein C family. This family includes the fast-, slow- and cardiac-type isoforms, each of which is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. The protein encoded by this locus is referred to as the fast-type isoform. Mutations in the related but distinct genes encoding the slow-type and cardiac-type isoforms have been associated with distal arthrogryposis, type 1 and hypertrophic cardiomyopathy, respectively. [provided by RefSeq, Jul 2012] |
| Function | Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. [UniProt] |
| Calculated MW | 128 kDa |
Images (1) Click the Picture to Zoom In
-
ARG40423 anti-MYBPC2 antibody WB image
Western blot: Human muscle lysate stained with ARG40423 anti-MYBPC2 antibody at 0.2 - 1 ug/ml dilution.
