ARG59148

anti-MEGF6 antibody

anti-MEGF6 antibody for Western blot and Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes MEGF6
Tested Reactivity Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name MEGF6
Antigen Species Rat
Immunogen Synthetic peptide around the middle region of Rat MEGF6. (within the following region: RRGCTSLEESVVDLDGRLPFVRPLPHIAVLRDELPRLFQDDYGAEEEAAA)
Conjugation Un-conjugated
Alternate Names Multiple EGF-like domains protein 6; EGF-like protein 3; EGFL3; Epidermal growth factor-like protein 3; Multiple epidermal growth factor-like domains protein 6

Application Instructions

Application Suggestion
Tested Application Dilution
WB1 - 3 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control Rat lung

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 65049 Rat MEGF6

Swiss-port # O88281 Rat Multiple epidermal growth factor-like domains protein 6

Gene Symbol MEGF6
Gene Full Name multiple EGF-like-domains 6
Cellular Localization Secreted. [UniProt]
Calculated MW 165 kDa (Rat)

Images (1) Click the Picture to Zoom In

  • ARG59148 anti-MEGF6 antibody WB image

    Western blot: Rat lung lysate stained with ARG59148 anti-MEGF6 antibody at 1 µg/ml dilution.