ARG59148
anti-MEGF6 antibody
anti-MEGF6 antibody for Western blot and Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes MEGF6 |
---|---|
Tested Reactivity | Rat |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | MEGF6 |
Antigen Species | Rat |
Immunogen | Synthetic peptide around the middle region of Rat MEGF6. (within the following region: RRGCTSLEESVVDLDGRLPFVRPLPHIAVLRDELPRLFQDDYGAEEEAAA) |
Conjugation | Un-conjugated |
Alternate Names | Multiple EGF-like domains protein 6; EGF-like protein 3; EGFL3; Epidermal growth factor-like protein 3; Multiple epidermal growth factor-like domains protein 6 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
Positive Control | Rat lung |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links |
Swiss-port # O88281 Rat Multiple epidermal growth factor-like domains protein 6 |
---|---|
Gene Symbol | MEGF6 |
Gene Full Name | multiple EGF-like-domains 6 |
Cellular Localization | Secreted. [UniProt] |
Calculated MW | 165 kDa (Rat) |
Images (1) Click the Picture to Zoom In