ARG41257
anti-KIF3B antibody
anti-KIF3B antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes KIF3B |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | KIF3B |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the C-terminal region of Human KIF3B. (within the following region: SGGGGEEEEEEGEEGEEEGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEE) |
| Conjugation | Un-conjugated |
| Alternate Names | Microtubule plus end-directed kinesin motor 3B; HH0048; KLP-11; FLA8; Kinesin-like protein KIF3B |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Observed Size | 85 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | KIF3B |
| Gene Full Name | kinesin family member 3B |
| Background | The protein encoded by this gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved in the intracellular movement of membranous organelles. This protein and kinesin family member 3A form the kinesin II subfamily of the kinesin superfamily. [provided by RefSeq, Jul 2008] |
| Function | Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro (By similarity). [UniProt] |
| Cellular Localization | Cytoplasm, cytoskeleton. Cell projection, cilium. [UniProt] |
| Calculated MW | 85 kDa |
Images (1) Click the Picture to Zoom In
-
ARG41257 anti-KIF3B antibody WB image
Western blot: MCF7 whole cell lysate stained with ARG41257 anti-KIF3B antibody at 1 µg/ml dilution.
