ARG59333
anti-KChIP2 antibody
anti-KChIP2 antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes KChIP2 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Predict Reactivity | Chk |
| Tested Application | FACS, ICC/IF, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | KChIP2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 78-112 of Human KChIP2. (DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR) |
| Conjugation | Un-conjugated |
| Alternate Names | Potassium channel-interacting protein 2; A-type potassium channel modulatory protein 2; Kv channel-interacting protein 2; Cardiac voltage-gated potassium channel modulatory subunit; KCHIP2; KChIP2 |
Application Instructions
| Application Suggestion |
|
||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | KCNIP2 |
| Gene Full Name | Kv channel interacting protein 2 |
| Background | This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. [provided by RefSeq, Jul 2008] |
| Function | Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Involved in KCND2 and KCND3 trafficking to the cell surface. May be required for the expression of I(To) currents in the heart (By similarity). [UniProt] |
| Cellular Localization | Isoform 1: Cell membrane; Lipid-anchor. Note=Detected on lipid rafts (By similarity). Isoform 2: Cell membrane; Lipid-anchor. Isoform 6: Cell membrane; Lipid-anchor. [UniProt] |
| Calculated MW | 31 kDa |
| PTM | Palmitoylated. Palmitoylation enhances association with the plasma membrane. [UniProt] |
Images (6) Click the Picture to Zoom In
-
ARG59333 anti-KChIP2 antibody ICC/IF image
Immunofluorescence: SH-SY5Y cells were blocked with 10% goat serum and then stained with ARG59333 anti-KChIP2 antibody (green) at 2 µg/ml dilution, overnight at 4°C. DAPI (blue) for nuclear staining.
-
ARG59333 anti-KChIP2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse brain stained with ARG59333 anti-KChIP2 antibody.
-
ARG59333 anti-KChIP2 antibody WB image
Western blot: 50 ug of Rat brain, 50 ug of Rat cardiac muscle, 50 ug of Mouse cardiac muscle and 40 ug of 22RV1 whole cell lysates stained wtih ARG59333 anti-KChIP2 antibody at 0.5 ug/ml dilution.
-
ARG59333 anti-KChIP2 antibody FACS image
Flow Cytometry: K562 cells were blocked with 10% normal goat serum and then stained with ARG59333 anti-KChIP2 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG59333 anti-KChIP2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human glioma stained with ARG59333 anti-KChIP2 antibody.
-
ARG59333 anti-KChIP2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat brain stained with ARG59333 anti-KChIP2 antibody.
