ARG59655
anti-HDGF antibody
anti-HDGF antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes HDGF |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, ICC/IF, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | HDGF |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 61-97 of Human HDGF. (KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA) |
| Conjugation | Un-conjugated |
| Alternate Names | HMG1L2; HMG-1L2; HDGF; High mobility group protein 1-like 2; Hepatoma-derived growth factor |
Application Instructions
| Application Suggestion |
|
||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | HDGF |
| Gene Full Name | hepatoma-derived growth factor |
| Background | HDGF is a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. This gene was thought initially to be located on chromosome X; however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jan 2016] |
| Function | HDGF Isoform 1: Acts as a transcriptional repressor (PubMed:17974029). Has mitogenic activity for fibroblasts (PubMed:11751870, PubMed:26845719). Heparin-binding protein (PubMed:15491618). Isoform 2: Does not have mitogenic activity for fibroblasts (PubMed:26845719). Does not bind heparin (PubMed:26845719). Isoform 3: Has mitogenic activity for fibroblasts (PubMed:26845719). Heparin-binding protein (PubMed:26845719). [UniProt] |
| Cellular Localization | Cytoplasm. Nucleus. [UniProt] |
| Highlight | Related products: HDGF antibodies; HDGF ELISA Kits; Anti-Rabbit IgG secondary antibodies; Related news: The role of HDGF in tumor angiogenesis |
| Calculated MW | 27 kDa |
| PTM | Sumoylated with SUMO1. Sumoylation prevents binding to chromatin. [UniProt] |
Images (7) Click the Picture to Zoom In
-
ARG59655 anti-HDGF antibody ICC/IF image
Immunofluorescence: U2OS cells were blocked with 10% goat serum and then stained with ARG59655 anti-HDGF antibody (green) at 2 µg/ml dilution, overnight at 4°C. DAPI (blue) for nuclear staining.
-
ARG59655 anti-HDGF antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse liver stained with ARG59655 anti-HDGF antibody at 1 µg/ml dilution.
-
ARG59655 anti-HDGF antibody WB image
Western blot: Rat liver and 22RV1 whole cell lysates stained with ARG59655 anti-HDGF antibody at 0.5 µg/ml dilution.
-
ARG59655 anti-HDGF antibody FACS image
Flow Cytometry: A431 cells were blocked with 10% normal goat serum and then stained with ARG59655 anti-HDGF antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG59655 anti-HDGF antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat liver stained with ARG59655 anti-HDGF antibody at 1 µg/ml dilution.
-
ARG59655 anti-HDGF antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human intestinal cancer stained with ARG59655 anti-HDGF antibody at 1 µg/ml dilution.
-
ARG59655 anti-HDGF antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human lung cancer stained with ARG59655 anti-HDGF antibody at 1 µg/ml dilution.
