ARG59543
anti-GRK2 antibody
anti-GRK2 antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes GRK2 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, ICC/IF, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | GRK2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human GRK2. (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK) |
| Conjugation | Un-conjugated |
| Alternate Names | BETA-ARK1; Beta-adrenergic receptor kinase 1; GRK2; BARK1; EC 2.7.11.15; Beta-ARK-1; G-protein coupled receptor kinase 2 |
Application Instructions
| Application Suggestion |
|
||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | ADRBK1 |
| Gene Full Name | adrenergic, beta, receptor kinase 1 |
| Background | The product of this gene phosphorylates the beta-2-adrenergic receptor and appears to mediate agonist-specific desensitization observed at high agonist concentrations. This protein is an ubiquitous cytosolic enzyme that specifically phosphorylates the activated form of the beta-adrenergic and related G-protein-coupled receptors. Abnormal coupling of beta-adrenergic receptor to G protein is involved in the pathogenesis of the failing heart. [provided by RefSeq, Jul 2008] |
| Function | Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them. Key regulator of LPAR1 signaling. Competes with RALA for binding to LPAR1 thus affecting the signaling properties of the receptor. Desensitizes LPAR1 and LPAR2 in a phosphorylation-independent manner. [UniProt] |
| Cellular Localization | Cytoplasm. Cell membrane. [UniProt] |
| Calculated MW | 80 kDa |
Images (6) Click the Picture to Zoom In
-
ARG59543 anti-GRK2 antibody ICC/IF image
Immunofluorescence: U2OS cells were blocked with 10% goat serum and then stained with ARG59543 anti-GRK2 antibody (green) at 2 µg/ml dilution, overnight at 4°C. DAPI (blue) for nuclear staining.
-
ARG59543 anti-GRK2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human lung cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59543 anti-GRK2 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG59543 anti-GRK2 antibody WB image
Western blot: 50 µg of samples under reducing conditions. Rat spleen, Rat stomach, Mouse lung, Mouse liver and Mouse pancreas lysates stained with ARG59543 anti-GRK2 antibody at 0.5 µg/ml, overnight at 4°C.
-
ARG59543 anti-GRK2 antibody FACS image
Flow Cytometry: U87 cells were blocked with 10% normal goat serum and then stained with ARG59543 anti-GRK2 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG59543 anti-GRK2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse spleen tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59543 anti-GRK2 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG59543 anti-GRK2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat spleen tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59543 anti-GRK2 antibody at 1 µg/ml dilution, overnight at 4°C.
