ARG41411

anti-GABARAPL1 antibody

anti-GABARAPL1 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes GABARAPL1
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name GABARAPL1
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human GABARAPL1. (within the following region: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL)
Conjugation Un-conjugated
Alternate Names A; Gamma-aminobutyric acid receptor-associated protein-like 1; Glandular epithelial cell protein 1; GEC1; Early estrogen-regulated protein; APG8-LIKE; GEC-1; ATG8L; ATG8; APG8L; ATG8B; GABA

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Application Suggestion
Tested Application Dilution
IHC-P5 µg/ml
WB1 µg/ml
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control 293T
Observed Size ~ 14 kDa

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent within range: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 23710 Human GABARAPL1

Swiss-port # Q9H0R8 Human Gamma-aminobutyric acid receptor-associated protein-like 1

Gene Symbol GABARAPL1
Gene Full Name GABA(A) receptor-associated protein like 1
Function Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. [UniProt]
Cellular Localization Cytoplasm, cytoskeleton. Cytoplasmic vesicle membrane; Lipid-anchor. Endoplasmic reticulum. Golgi apparatus. Cytoplasmic vesicle, autophagosome. [UniProt]
Calculated MW 14 kDa
PTM The precursor molecule is cleaved by ATG4B to form the cytosolic form, GABARAPL1-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, GABARAPL1-II (By similarity). ATG4B also mediates the delipidation required for GABARAPL1 recycling when autophagosomes fuse with lysosomes (PubMed:20404487).

The Legionella effector RavZ is a deconjugating enzyme that produces an ATG8 product that would be resistant to reconjugation by the host machinery due to the cleavage of the reactive C-terminal glycine. [UniProt]

Images (3) Click the Picture to Zoom In

  • ARG41411 anti-GABARAPL1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human brain tissue stained with ARG41411 anti-GABARAPL1 antibody at 5 µg/ml dilution.

  • ARG41411 anti-GABARAPL1 antibody WB image

    Western blot: HEK293T cell lysate stained with ARG41411 anti-GABARAPL1 antibody at 1 µg/ml dilution.

  • ARG41411 anti-GABARAPL1 antibody IHC-P image

    Immunohistochemistry: Formalin-fixed and paraffin-embedded Human spleen tissue. Antigen Retrieval: Heat mediation was performed. Tissue section was stained with ARG41411 anti-GABARAPL1 antibody at 5 µg/ml dilution.