ARG58548
anti-Cystatin SN antibody
anti-Cystatin SN antibody for Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes Cystatin SN |
---|---|
Tested Reactivity | Hu |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | Cystatin SN |
Antigen Species | Human |
Immunogen | Synthetic peptide around the Middle region of Human Cystatin SN. (within the following sequence: AISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPN) |
Conjugation | Un-conjugated |
Alternate Names | Salivary cystatin-SA-1; Cystain-SA-I; Cystatin-1; Cystatin-SN |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | CST1 |
Gene Full Name | cystatin SN |
Background | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid. [provided by RefSeq, Jul 2008] |
Function | Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to cystatin S but that differ in their specificity due to amino acid sequence differences. Cystatin SN, with a pI of 7.5, is a much better inhibitor of papain and dipeptidyl peptidase I than is cystatin S, although both inhibit ficin equally well. [UniProt] |
Calculated MW | 16 kDa |
Images (1) Click the Picture to Zoom In