ARG42599
anti-CutA antibody
anti-CutA antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes CutA |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | CutA |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the center region of Human CutA. (within the following region: AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL) |
| Conjugation | Un-conjugated |
| Alternate Names | Acetylcholinesterase-associated protein; Brain acetylcholinesterase putative membrane anchor; Protein CutA; ACHAP; C6orf82 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | IHC-P: Antigen Retrieval: Heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||
| Positive Control | THP-1 | ||||||
| Observed Size | ~ 20 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | CUTA |
| Gene Full Name | cutA divalent cation tolerance homolog (E. coli) |
| Function | May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE). [UniProt] |
| Calculated MW | 19 kDa |
| PTM | O-glycosylated. [UniProt] |
Images (2) Click the Picture to Zoom In
-
ARG42599 anti-CutA antibody IHC-P image
Immunohistochemistry: Formalin-fixed and paraffin-embedded Human kidney tissue. Antigen Retrieval: Heat mediation. The tissue section was stained with ARG42599 anti-CutA antibody at 10 µg/ml dilution.
-
ARG42599 anti-CutA antibody WB image
Western blot: THP-1 cell lysate stained with ARG42599 anti-CutA antibody at 0.2 - 1 µg/ml dilution.
