ARG41696
anti-Claudin 18 antibody
anti-Claudin 18 antibody for Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes Claudin 18 |
---|---|
Tested Reactivity | Hu |
Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | Claudin 18 |
Antigen Species | Human |
Immunogen | Synthetic peptide around the C-terminal region of Human Claudin 18. (within the following region: PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE) |
Conjugation | Un-conjugated |
Alternate Names | Claudin-18; SFTPJ; SFTA5 |
Application Instructions
Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 85%; Dog: 79%; Guinea pig: 92%; Horse: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100% | ||||
---|---|---|---|---|---|
Application Suggestion |
|
||||
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
Positive Control | Jurkat | ||||
Observed Size | ~ 28 kDa |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | CLDN18 |
Gene Full Name | claudin 18 |
Background | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is upregulated in patients with ulcerative colitis and highly overexpressed in infiltrating ductal adenocarcinomas. PKC/MAPK/AP-1 (protein kinase C/mitogen-activated protein kinase/activator protein-1) dependent pathway regulates the expression of this gene in gastric cells. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jun 2010] |
Function | Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. [UniProt] |
Cellular Localization | Cell junction, tight junction. Cell membrane; Multi-pass membrane protein. [UniProt] |
Calculated MW | 28 kDa |
Images (2) Click the Picture to Zoom In
-
ARG41696 anti-Claudin 18 antibody WB image
Western blot: Jurkat cell lysate stained with ARG41696 anti-Claudin 18 antibody at 1 µg/ml dilution.
-
ARG41696 anti-Claudin 18 antibody WB image
Western blot: 25 µg of Jurkat cell lysates stained with ARG41696 anti-Claudin 18 antibody at 1 µg/ml dilution. The antibody was used in the presence (right) or the absence (left) of blocking peptide.