ARG41306
anti-CSRP3 antibody
anti-CSRP3 antibody for Western blot and Human,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes CSRP3 |
---|---|
Tested Reactivity | Hu, Rat |
Predict Reactivity | Ms, Cow, Dog, Gpig, Hrs, Rb |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | CSRP3 |
Antigen Species | Human |
Immunogen | Synthetic peptide around the middle region of Human CSRP3. (within the following region: QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCG) |
Conjugation | Un-conjugated |
Alternate Names | CMH12; LIM domain protein, cardiac; Cysteine and glycine-rich protein 3; LMO4; Muscle LIM protein; MLP; CMD1M; CRP3; Cysteine-rich protein 3; Cardiac LIM protein; CLP |
Application Instructions
Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100% | ||||
---|---|---|---|---|---|
Application Suggestion |
|
||||
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
Positive Control | Human heart |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links |
Swiss-port # P50461 Human Cysteine and glycine-rich protein 3 |
---|---|
Gene Symbol | CSRP3 |
Gene Full Name | cysteine and glycine-rich protein 3 (cardiac LIM protein) |
Background | This gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in this gene are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008] |
Function | Positive regulator of myogenesis. Plays a crucial and specific role in the organization of cytosolic structures in cardiomyocytes. Could play a role in mechanical stretch sensing. May be a scaffold protein that promotes the assembly of interacting proteins at Z-line structures. It is essential for calcineurin anchorage to the Z line. Required for stress-induced calcineurin-NFAT activation (By similarity). [UniProt] |
Cellular Localization | Nucleus. Cytoplasm. Cytoplasm, cytoskeleton. Cytoplasm, myofibril, sarcomere, Z line. Cytoplasm, myofibril, sarcomere. Note=Nucleocytoplasmic shuttling protein. Mainly cytoplasmic. In the Z line, found associated with GLRX3 (By similarity). Isoform 2: Cytoplasm, myofibril, sarcomere, Z line. [UniProt] |
Calculated MW | 21 kDa |
PTM | Phosphorylated by PKC/PRKCA. [UniProt] |
Images (1) Click the Picture to Zoom In