ARG58839
anti-CD127 / IL7R antibody
anti-CD127 / IL7R antibody for Flow cytometry,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes CD127 / IL7R |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Rat |
| Tested Application | FACS, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | CD127 / IL7R |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 278-315 of Human CD127 (DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ). |
| Conjugation | Un-conjugated |
| Alternate Names | ILRA; CD127; IL-7R subunit alpha; IL-7R-alpha; IL7RA; CD antigen CD127; Interleukin-7 receptor subunit alpha; CDW127; CDw127; IL-7 receptor subunit alpha; IL-7RA |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P16871 Human Interleukin-7 receptor subunit alpha |
|---|---|
| Gene Symbol | IL7R |
| Gene Full Name | interleukin 7 receptor |
| Background | The protein encoded by this gene is a receptor for interleukine 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukine 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in the V(D)J recombination during lymphocyte development. This protein is also found to control the accessibility of the TCR gamma locus by STAT5 and histone acetylation. Knockout studies in mice suggested that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. The functional defects in this protein may be associated with the pathogenesis of the severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, May 2014] |
| Function | Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP). [UniProt] |
| Cellular Localization | Isoform 1: Cell membrane; Single-pass type I membrane protein. [UniProt] |
| Calculated MW | 52 kDa |
| PTM | N-glycosylated IL-7Ralpha binds IL7 300-fold more tightly than the unglycosylated form. [UniProt] |
Images (3) Click the Picture to Zoom In
-
ARG58839 anti-CD127 / IL7R antibody WB image
Western blot: 22RV1 cell lysate stained with ARG58839 anti-CD127 / IL7R antibody at 0.5 µg/ml dilution.
-
ARG58839 anti-CD127 / IL7R antibody FACS image
Flow Cytometry: U2OS cells were blocked with 10% normal goat serum and then stained with ARG58839 anti-CD127 / IL7R antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG58839 anti-CD127 / IL7R antibody FACS image
Flow Cytometry: U87 cells were blocked with 10% normal goat serum and then stained with ARG58839 anti-CD127 / IL7R antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
