ARG58839

anti-CD127 / IL7R antibody

anti-CD127 / IL7R antibody for Flow cytometry,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes CD127 / IL7R
Tested Reactivity Hu
Predict Reactivity Rat
Tested Application FACS, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name CD127 / IL7R
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 278-315 of Human CD127 (DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ).
Conjugation Un-conjugated
Alternate Names ILRA; CD127; IL-7R subunit alpha; IL-7R-alpha; IL7RA; CD antigen CD127; Interleukin-7 receptor subunit alpha; CDW127; CDw127; IL-7 receptor subunit alpha; IL-7RA

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1:150 - 1:500
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 3575 Human IL7R

Swiss-port # P16871 Human Interleukin-7 receptor subunit alpha

Gene Symbol IL7R
Gene Full Name interleukin 7 receptor
Background The protein encoded by this gene is a receptor for interleukine 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukine 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in the V(D)J recombination during lymphocyte development. This protein is also found to control the accessibility of the TCR gamma locus by STAT5 and histone acetylation. Knockout studies in mice suggested that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. The functional defects in this protein may be associated with the pathogenesis of the severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, May 2014]
Function Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP). [UniProt]
Cellular Localization Isoform 1: Cell membrane; Single-pass type I membrane protein. [UniProt]
Calculated MW 52 kDa
PTM N-glycosylated IL-7Ralpha binds IL7 300-fold more tightly than the unglycosylated form. [UniProt]

Images (3) Click the Picture to Zoom In

  • ARG58839 anti-CD127 / IL7R antibody WB image

    Western blot: 22RV1 cell lysate stained with ARG58839 anti-CD127 / IL7R antibody at 0.5 µg/ml dilution.

  • ARG58839 anti-CD127 / IL7R antibody FACS image

    Flow Cytometry: U2OS cells were blocked with 10% normal goat serum and then stained with ARG58839 anti-CD127 / IL7R antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.

  • ARG58839 anti-CD127 / IL7R antibody FACS image

    Flow Cytometry: U87 cells were blocked with 10% normal goat serum and then stained with ARG58839 anti-CD127 / IL7R antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.