ARG58316
anti-ATP2A3 / SERCA3 ATPase antibody
anti-ATP2A3 / SERCA3 ATPase antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes ATP2A3 / SERCA3 ATPase |
|---|---|
| Tested Reactivity | Ms, Rat |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | ATP2A3 / SERCA3 ATPase |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of Human ATP2A3(1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related Mouse sequence by five amino acids, and from the related Rat sequence by six amino acids. |
| Conjugation | Un-conjugated |
| Alternate Names | SERCA3; SR Ca; Sarcoplasmic/endoplasmic reticulum calcium ATPase 3; EC 3.6.3.8; Calcium pump 3; 2+ |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P18596 Rat Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 Swiss-port # Q64518 Mouse Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 |
|---|---|
| Gene Symbol | ATP2A3 |
| Gene Full Name | ATPase, Ca++ transporting, ubiquitous |
| Background | This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. [UniProt] |
| Cellular Localization | Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Sarcoplasmic reticulum membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 114 kDa |
Images (3) Click the Picture to Zoom In
-
ARG58316 anti-ATP2A3 / SERCA3 ATPase antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse thymus stained with ARG58316 anti-ATP2A3 / SERCA3 ATPase antibody.
-
ARG58316 anti-ATP2A3 / SERCA3 ATPase antibody WB image
Western blot: 50 µg of Rat skeletal muscle and Mouse skeletal muscle lysates stained with ARG58316 anti-ATP2A3 / SERCA3 ATPase antibody at 0.5 µg/ml dilution.
-
ARG58316 anti-ATP2A3 / SERCA3 ATPase antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat thymus stained with ARG58316 anti-ATP2A3 / SERCA3 ATPase antibody.
