ARG58547
anti-gamma Crystallin C antibody
anti-gamma Crystallin C antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes gamma Crystallin C |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Cow, Rat, Dog, Hrs, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | gamma Crystallin C |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human gamma Crystallin C. (within the following sequence: GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE) |
| Conjugation | Un-conjugated |
| Alternate Names | CTRCT2; Gamma-crystallin 3; CRYG3; Gamma-C-crystallin; CCL; Gamma-crystallin 2-1; Gamma-crystallin C |
Application Instructions
| Predict Reactivity Note | Predicted homology based on immunogen sequence: Cow: 79%; Dog: 93%; Horse: 86%; Rabbit: 86%; Rat: 79% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | OVCAR-3 |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | CRYGC |
| Gene Full Name | crystallin, gamma C |
| Background | This gene encodes a member of the beta/gamma-crystallin family of proteins. Crystallins constitute the major proteins of vertebrate eye lens and maintain the transparency and refractive index of the lens. This gene and several family members are present in a gene cluster on chromosome 2. Mutations in this gene have been shown to cause multiple types of cataract, including Coppock-like cataract and zonular pulverulent cataract, among others. [provided by RefSeq, Jan 2015] |
| Function | Crystallins are the dominant structural components of the vertebrate eye lens. [UniProt] |
| Calculated MW | 21 kDa |
Images (1) Click the Picture to Zoom In
-
ARG58547 anti-gamma Crystallin C antibody WB image
Western blot: OVCAR-3 cell lysate stained with ARG58547 anti-gamma Crystallin C antibody at 0.2 - 1 µg/ml dilution.
