ARG41263

anti-VPS4B antibody

Datasheet

Ordering Information

Package

Price (USD)

50 μl

325.00

Add to cart

Datasheet

Overview

Product Description	Rabbit Polyclonal antibody recognizes VPS4B
Tested Reactivity	Hu
Predict Reactivity	Cow, Rat, Dog, Gpig, Hrs, Rb
Tested Application	WB
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Target Name	VPS4B
Antigen Species	Human
Immunogen	Synthetic peptide located within the following region: EKLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGEGESDDPEKKKLQNQ
Conjugation	Un-conjugated
Alternate Names	VPS4-2; Suppressor of K; SKD1; SKD1B; Vacuolar protein sorting-associated protein 4B; MIG1; Protein SKD1; EC 3.6.4.6; Cell migration-inducing gene 1 protein

Application Instructions

Predict Reactivity Note

Predicted Homology Based On Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Rabbit: 86%; Rat: 100%

Application Suggestion

Tested Application	Dilution
WB	1 µg/ml

Application Note

* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Positive Control

OVCAR-3

Observed Size

~ 50 kDa

Properties

Form	Liquid
Purification	Affinity purified.
Buffer	PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative	0.09% (w/v) Sodium azide
Stabilizer	2% Sucrose
Concentration	Batch dependent: 0.5 - 1 mg/ml
Storage Instruction	For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note	For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links	GeneID: 9525 Human VPS4B Swiss-port # O75351 Human Vacuolar protein sorting-associated protein 4B
Gene Symbol	VPS4B
Gene Full Name	vacuolar protein sorting 4 homolog B (S. cerevisiae)
Background	The protein encoded by this gene is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. The former share a high degree of aa sequence similarity with each other, and also with yeast Vps4 and mouse Skd1 proteins. Mouse Skd1 (suppressor of K+ transport defect 1) has been shown to be a yeast Vps4 ortholog. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast. The gene encoding this paralog has been mapped to chromosome 18; the gene for the other resides on chromosome 16. [provided by RefSeq, Jul 2008]
Function	Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (HIV-1 and other lentiviruses). [UniProt]
Cellular Localization	Prevacuolar compartment membrane; Peripheral membrane protein. Late endosome membrane; Peripheral membrane protein. Note=Membrane-associated in the prevacuolar endosomal compartment. Localized in HIV-1 particles purified from acutely infected cells. [UniProt]
Calculated MW	49 kDa