ARG58938
anti-UTS2R / GPR14 antibody
anti-UTS2R / GPR14 antibody for Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes UTS2R / GPR14 |
---|---|
Tested Reactivity | Hu |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | UTS2R / GPR14 |
Antigen Species | Human |
Immunogen | Synthetic peptide from Human UTS2R / GPR14. (within the following region: WGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRRSQRASFKRARRP) |
Conjugation | Un-conjugated |
Alternate Names | Urotensin-2 receptor; GPR14; Urotensin II receptor; UR-2-R; UTR; UR-II-R; G-protein coupled receptor 14; UTR2 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
Positive Control | Human fetal heart |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | UTS2R |
Gene Full Name | urotensin 2 receptor |
Function | High affinity receptor for urotensin-2 and urotensin-2B. The activity of this receptor is mediated by a G-protein that activate a phosphatidylinositol-calcium second messenger system. [UniProt] |
Cellular Localization | Cell membrane; Multi-pass membrane protein. [UniProt] |
Calculated MW | 42 kDa |
Images (1) Click the Picture to Zoom In