ARG59484
anti-UHRF2 / NIRF antibody
anti-UHRF2 / NIRF antibody for Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes UHRF2 / NIRF |
---|---|
Tested Reactivity | Hu |
Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | UHRF2 / NIRF |
Antigen Species | Human |
Immunogen | Synthetic peptide around the N-terminal region of Human UHRF2 / NIRF. (within the following region: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART) |
Conjugation | Un-conjugated |
Alternate Names | Nuclear zinc finger protein Np97; EC 6.3.2.-; Ubiquitin-like PHD and RING finger domain-containing protein 2; RING finger protein 107; Nuclear protein 97; Np95-like RING finger protein; RNF107; NIRF; URF2; Np95/ICBP90-like RING finger protein; Ubiquitin-like-containing PHD and RING finger domains protein 2; E3 ubiquitin-protein ligase UHRF2 |
Application Instructions
Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea pig: 93%; Horse: 86%; Mouse: 86%; Rabbit: 100%; Rat: 93% | ||||
---|---|---|---|---|---|
Application Suggestion |
|
||||
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
Positive Control | Jurkat | ||||
Observed Size | ~ 85 kDa |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | UHRF2 |
Gene Full Name | ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase |
Background | This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding. [provided by RefSeq, Feb 2012] |
Function | E3 ubiquitin-protein ligase that is an intermolecular hub protein in the cell cycle network. Through cooperative DNA and histone binding, may contribute to a tighter epigenetic control of gene expression in differentiated cells. Ubiquitinates cyclins, CCND1 and CCNE1, in an apparently phosphorylation-independent manner and induces G1 arrest. Also ubiquitinates PCNP leading to its degradation by the proteasome. E3 SUMO-, but not ubiquitin-, protein ligase for ZNF131. [UniProt] |
Cellular Localization | Nucleus. Note=Enriched at pericentric heterochromatin (PH). This localization is dependent on the interaction with H3K9me3 (By similarity). [UniProt] |
Calculated MW | 90 kDa |
PTM | May be autoubiquitinated; which may lead to proteasomal degradation. Phosphorylated. Phosphorylation may be mediated by CDK2. Autosumoylated. [UniProt] |
Images (1) Click the Picture to Zoom In