ARG59226
anti-UBA3 antibody
anti-UBA3 antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes UBA3 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Predict Reactivity | Bov, Dog, Hrs, Mk, Rb |
| Tested Application | FACS, ICC/IF, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | UBA3 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 409-448 of Human UBA3. (KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD) |
| Conjugation | Un-conjugated |
| Alternate Names | EC 6.3.2.-; Ubiquitin-activating enzyme E1C; UBE1C; Ubiquitin-like modifier-activating enzyme 3; Ubiquitin-activating enzyme 3; NAE2; hUBA3; NEDD8-activating enzyme E1 catalytic subunit; NEDD8-activating enzyme E1C |
Application Instructions
| Application Suggestion |
|
||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | UBA3 |
| Gene Full Name | ubiquitin-like modifier activating enzyme 3 |
| Background | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Function | Catalytic subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. Down-regulates steroid receptor activity. Necessary for cell cycle progression. [UniProt] |
| Calculated MW | 52 kDa |
Images (5) Click the Picture to Zoom In
-
ARG59226 anti-UBA3 antibody ICC/IF image
Immunofluorescence: A431 cells were blocked with 10% goat serum and then stained with ARG59226 anti-UBA3 antibody (green) at 2 µg/ml dilution, overnight at 4°C. DAPI (blue) for nuclear staining.
-
ARG59226 anti-UBA3 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse testis stained with ARG59226 anti-UBA3 antibody.
-
ARG59226 anti-UBA3 antibody WB image
Western blot: 50 µg of Rat brain and 40 µg of HeLa whole cell lysates stained with ARG59226 anti-UBA3 antibody at 0.5 µg/ml dilution.
-
ARG59226 anti-UBA3 antibody FACS image
Flow Cytometry: A549 cells were blocked with 10% normal goat serum and then stained with ARG59226 anti-UBA3 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG59226 anti-UBA3 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat testis stained with ARG59226 anti-UBA3 antibody.
