ARG41090
anti-Transferrin antibody
anti-Transferrin antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Transferrin |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Transferrin |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 20-49 of Human Transferrin. (VPDKTVRWCAVSEHEATKCQSFRDHMKSVI) |
| Conjugation | Un-conjugated |
| Alternate Names | Beta-1 metal-binding globulin; Siderophilin; Transferrin; PRO1557; TFQTL1; Serotransferrin; PRO2086 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Observed Size | 77 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | TF |
| Gene Full Name | transferrin |
| Background | This gene encodes a glycoprotein with an approximate molecular weight of 76.5 kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum. [provided by RefSeq, Sep 2009] |
| Function | Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also have a further role in stimulating cell proliferation. [UniProt] |
| Cellular Localization | Secreted. [UniProt] |
| Calculated MW | 77 kDa |
Images (4) Click the Picture to Zoom In
-
ARG41090 anti-Transferrin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse liver tissue stained with ARG41090 anti-Transferrin antibody.
-
ARG41090 anti-Transferrin antibody WB image
Western blot: 50 µg of Human placenta and Rat thymus tissue lysates stained with ARG41090 anti-Transferrin antibody at 0.5 µg/ml dilution.
-
ARG41090 anti-Transferrin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat liver tissue stained with ARG41090 anti-Transferrin antibody.
-
ARG41090 anti-Transferrin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human intestinal cancer tissue stained with ARG41090 anti-Transferrin antibody.
