ARG41392
anti-TYROBP / DAP12 antibody
anti-TYROBP / DAP12 antibody for Western blot and Human,Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes TYROBP / DAP12 |
|---|---|
| Tested Reactivity | Hu, Ms |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | TYROBP / DAP12 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human TYROBP / DAP12. (within the following region: IALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLN) |
| Conjugation | Un-conjugated |
| Alternate Names | TYRO protein tyrosine kinase-binding protein; DNAX-activation protein 12; DAP12; PLOSL; KARAP; KAR-associated protein; Killer-activating receptor-associated protein |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | HepG2 | ||||
| Observed Size | ~ 16 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # O43914 Human TYRO protein tyrosine kinase-binding protein Swiss-port # O54885 Mouse TYRO protein tyrosine kinase-binding protein |
|---|---|
| Gene Symbol | TYROBP |
| Gene Full Name | TYRO protein tyrosine kinase binding protein |
| Background | This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Mar 2010] |
| Function | Non-covalently associates with activating receptors of the CD300 family. Cross-linking of CD300-TYROBP complexes results in cellular activation. Involved for instance in neutrophil activation mediated by integrin. [UniProt] |
| Cellular Localization | Membrane; Single-pass type I membrane protein. [UniProt] |
| Calculated MW | 12 kDa |
| PTM | Tyrosine phosphorylated. [UniProt] |
Images (2) Click the Picture to Zoom In
-
ARG41392 anti-TYROBP / DAP12 antibody WB image
Western blot: HepG2 whole cell lysate stained with ARG41392 anti-TYROBP / DAP12 antibody at 1 µg/ml dilution.
-
ARG41392 anti-TYROBP / DAP12 antibody WB image
Western blot: Mouse testis lysate stained with ARG41392 anti-TYROBP / DAP12 antibody at 1 µg/ml dilution.
