ARG40778
anti-TRPM2 antibody
anti-TRPM2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes TRPM2 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | TRPM2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human TRPM2. (Within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK) |
| Conjugation | Un-conjugated |
| Alternate Names | KNP3; Transient receptor potential cation channel subfamily M member 2; NUDT9H; EREG1; LTrpC2; TrpC7; EC 3.6.1.13; TRPC7; NUDT9L1; LTRPC2; LTrpC-2; Transient receptor potential channel 7; Long transient receptor potential channel 2; Estrogen-responsive element-associated gene 1 protein |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea pig: 88%; Horse: 93%; Mouse: 100%; Rat: 100% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # O94759 Human Transient receptor potential cation channel subfamily M member 2 |
|---|---|
| Gene Symbol | TRPM2 |
| Gene Full Name | transient receptor potential cation channel, subfamily M, member 2 |
| Background | The protein encoded by this gene is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Jul 2008] |
| Function | Nonselective, voltage-independent cation channel mediating sodium and calcium ion influx in response to oxidative stress. Extracellular calcium passes through the channel and acts from the intracellular side as a positive regulator in channel activation. Activated by ADP-ribose, nicotinamide adenine dinucleotide (NAD(+)), reactive nitrogen species and arachidonic acid. Inactivated by intracellular ATP. Confers susceptibility to cell death following oxidative stress. Isoform 2 does not seem to be regulated by ADPR. Has ADP-ribose pyrophosphatase activity. [UniProt] |
| Cellular Localization | Isoform 1,2 and 3: Cell membrane; Multi-pass membrane protein. Note=Detected at the cell membrane and in intracellular vesicles in cortical neurons. Detected on neuronal cell bodies and neurites. Detected on the cell membrane in polymorphonuclear neutrophils. Detected on cytoplasmic vesicles and lysosomes in immature bone marrow dendritic cells. [UniProt] |
| Calculated MW | 171 kDa |
Images (3) Click the Picture to Zoom In
-
ARG40778 anti-TRPM2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human heart tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40778 anti-TRPM2 antibody at 10 µg/ml, overnight at 4°C.
-
ARG40778 anti-TRPM2 antibody WB image
Western blot: Human fetal liver lysate stained with ARG40778 anti-TRPM2 antibody at 1 µg/ml dilution.
-
ARG40778 anti-TRPM2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human brain tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40778 anti-TRPM2 antibody at 10 µg/ml, overnight at 4°C.
