ARG40722

anti-TRIM55 / MURF2 antibody

anti-TRIM55 / MURF2 antibody for Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes TRIM55 / MURF2
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name TRIM55 / MURF2
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human TRIM55. (within the following region: SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ)
Conjugation Un-conjugated
Alternate Names Muscle-specific RING finger protein 2; muRF2; MuRF-2; MURF-2; RNF29; MuRF2; RING finger protein 29; Tripartite motif-containing protein 55

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Application Suggestion
Tested Application Dilution
WB0.2 - 1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control Human brain
Observed Size ~ 60 kDa

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 84675 Human TRIM55

Swiss-port # Q9BYV6 Human Tripartite motif-containing protein 55

Gene Symbol TRIM55
Gene Full Name tripartite motif containing 55
Background The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]
Function May regulate gene expression and protein turnover in muscle cells. [UniProt]
Cellular Localization Cytoplasm. Nucleus. Note=Nuclear under atrophic conditions and upon mechanical signals. Localizes to the sarcomeric M-band in cardiomyocytes. Colocalizes in part with microtubules (By similarity). [UniProt]
Calculated MW 60 kDa

Images (1) Click the Picture to Zoom In

  • ARG40722 anti-TRIM55 / MURF2 antibody WB image

    Western blot: Human brain lysate stained with ARG40722 anti-TRIM55 / MURF2 antibody at 0.2 - 1 µg/ml dilution.