ARG41699
anti-TRIM31 antibody
anti-TRIM31 antibody for Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes TRIM31 |
---|---|
Tested Reactivity | Hu |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | TRIM31 |
Antigen Species | Human |
Immunogen | Synthetic peptide around the middle region of Human TRIM31. (within the following region: HSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAAL) |
Conjugation | Un-conjugated |
Alternate Names | EC 6.3.2.-; E3 ubiquitin-protein ligase TRIM31; Tripartite motif-containing protein 31; RNF; HCGI; HCG1; C6orf13 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
Positive Control | Human small intestine | ||||
Observed Size | ~ 48 kDa |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links |
Swiss-port # Q9BZY9 Human E3 ubiquitin-protein ligase TRIM31 |
---|---|
Gene Symbol | TRIM31 |
Gene Full Name | tripartite motif containing 31 |
Background | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus. Its function has not been identified. [provided by RefSeq, Jul 2008] |
Function | Regulator of Src-induced anchorage independent cell growth (By similarity). May have E3 ubiquitin-protein ligase activity. [UniProt] |
Cellular Localization | Cytoplasm. Mitochondrion. Note=Predominantly expressed in the cytoplasm but a fraction is associated with the mitochondria. [UniProt] |
Calculated MW | 48 kDa |
PTM | Auto-ubiquitinated (in vitro). [UniProt] |
Images (1) Click the Picture to Zoom In