ARG40190

anti-TMEM173 / STING antibody

anti-TMEM173 / STING antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes TMEM173 / STING
Tested Reactivity Hu
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name TMEM173 / STING
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 284-316 of Human TMEM173 / STING. (RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE)
Conjugation Un-conjugated
Alternate Names MPYS; hSTING; hMITA; Transmembrane protein 173; ERIS; STING; Stimulator of interferon genes protein; Mediator of IRF3 activation; SAVI; Endoplasmic reticulum interferon stimulator; NET23; MITA

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: By heat mediation.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 42 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 340061 Human TMEM173

Swiss-port # Q86WV6 Human Stimulator of interferon genes protein

Gene Symbol TMEM173
Gene Full Name transmembrane protein 173
Background This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses. The encoded protein has also been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex. Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014]
Function Facilitator of innate immune signaling that acts as a sensor of cytosolic DNA from bacteria and viruses and promotes the production of type I interferon (IFN-alpha and IFN-beta). Innate immune response is triggered in response to non-CpG double-stranded DNA from viruses and bacteria delivered to the cytoplasm. Acts by recognizing and binding cyclic di-GMP (c-di-GMP), a second messenger produced by bacteria, and cyclic GMP-AMP (cGAMP), a messenger produced in response to DNA virus in the cytosol: upon binding of c-di-GMP or cGAMP, autoinhibition is alleviated and TMEM173/STING is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon and exert a potent anti-viral state. May be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons. May be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II). Mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway. Essential for the induction of IFN-beta in response to human herpes simplex virus 1 (HHV-1) infection. [UniProt]
Cellular Localization Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region. Cytoplasm. In response to double-stranded DNA stimulation, relocalizes to perinuclear region, where the kinase TBK1 is recruited. [UniProt]
Highlight Related products:
TMEM173 antibodies; Anti-Rabbit IgG secondary antibodies;
Related news:
Exploring Antiviral Immune Response
Calculated MW 42 kDa
PTM Phosphorylated on tyrosine residues upon MHC-II aggregation (By similarity). Phosphorylated on Ser-358 by TBK1, leading to activation and production of IFN-beta.

Ubiquitinated (PubMed:19285439, PubMed:19433799, PubMed:21074459, PubMed:25254379). 'Lys-63'-linked ubiquitination mediated by TRIM56 at Lys-150 promotes homodimerization and recruitment of the antiviral kinase TBK1 and subsequent production of IFN-beta (PubMed:21074459). 'Lys-48'-linked polyubiquitination at Lys-150 occurring after viral infection is mediated by RNF5 and leads to proteasomal degradation (PubMed:19285439). 'Lys-11'-linked polyubiquitination at Lys-150 by RNF26 leads to stabilize TMEM173/STING: it protects TMEM173/STING from RNF5-mediated 'Lys-48'-linked polyubiquitination (PubMed:25254379). [UniProt]

Images (2) Click the Picture to Zoom In

  • ARG40190 anti-TMEM173 / STING antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human lung cancer tissue stained with ARG40190 anti-TMEM173 / STING antibody.

  • ARG40190 anti-TMEM173 / STING antibody WB image

    Western blot: 40 µg of A549 and HeLa whole cell lysates stained with ARG40190 anti-TMEM173 / STING antibody at 0.5 µg/ml dilution.