ARG40190
anti-TMEM173 / STING antibody
anti-TMEM173 / STING antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes TMEM173 / STING |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | TMEM173 / STING |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 284-316 of Human TMEM173 / STING. (RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE) |
| Conjugation | Un-conjugated |
| Alternate Names | MPYS; hSTING; hMITA; Transmembrane protein 173; ERIS; STING; Stimulator of interferon genes protein; Mediator of IRF3 activation; SAVI; Endoplasmic reticulum interferon stimulator; NET23; MITA |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||
| Observed Size | ~ 42 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q86WV6 Human Stimulator of interferon genes protein |
|---|---|
| Gene Symbol | TMEM173 |
| Gene Full Name | transmembrane protein 173 |
| Background | This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses. The encoded protein has also been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex. Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014] |
| Function | Facilitator of innate immune signaling that acts as a sensor of cytosolic DNA from bacteria and viruses and promotes the production of type I interferon (IFN-alpha and IFN-beta). Innate immune response is triggered in response to non-CpG double-stranded DNA from viruses and bacteria delivered to the cytoplasm. Acts by recognizing and binding cyclic di-GMP (c-di-GMP), a second messenger produced by bacteria, and cyclic GMP-AMP (cGAMP), a messenger produced in response to DNA virus in the cytosol: upon binding of c-di-GMP or cGAMP, autoinhibition is alleviated and TMEM173/STING is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon and exert a potent anti-viral state. May be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons. May be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II). Mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway. Essential for the induction of IFN-beta in response to human herpes simplex virus 1 (HHV-1) infection. [UniProt] |
| Cellular Localization | Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region. Cytoplasm. In response to double-stranded DNA stimulation, relocalizes to perinuclear region, where the kinase TBK1 is recruited. [UniProt] |
| Highlight | Related products: TMEM173 antibodies; Anti-Rabbit IgG secondary antibodies; Related news: Exploring Antiviral Immune Response |
| Calculated MW | 42 kDa |
| PTM | Phosphorylated on tyrosine residues upon MHC-II aggregation (By similarity). Phosphorylated on Ser-358 by TBK1, leading to activation and production of IFN-beta. Ubiquitinated (PubMed:19285439, PubMed:19433799, PubMed:21074459, PubMed:25254379). 'Lys-63'-linked ubiquitination mediated by TRIM56 at Lys-150 promotes homodimerization and recruitment of the antiviral kinase TBK1 and subsequent production of IFN-beta (PubMed:21074459). 'Lys-48'-linked polyubiquitination at Lys-150 occurring after viral infection is mediated by RNF5 and leads to proteasomal degradation (PubMed:19285439). 'Lys-11'-linked polyubiquitination at Lys-150 by RNF26 leads to stabilize TMEM173/STING: it protects TMEM173/STING from RNF5-mediated 'Lys-48'-linked polyubiquitination (PubMed:25254379). [UniProt] |
Images (2) Click the Picture to Zoom In
-
ARG40190 anti-TMEM173 / STING antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human lung cancer tissue stained with ARG40190 anti-TMEM173 / STING antibody.
-
ARG40190 anti-TMEM173 / STING antibody WB image
Western blot: 40 µg of A549 and HeLa whole cell lysates stained with ARG40190 anti-TMEM173 / STING antibody at 0.5 µg/ml dilution.
