ARG59133
anti-TAP1 antibody
anti-TAP1 antibody for IHC-Formalin-fixed paraffin-embedded sections and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes TAP1 |
---|---|
Tested Reactivity | Hu |
Tested Application | IHC-P |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | TAP1 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to aa. 438-471 of Human TAP1. (RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN) |
Conjugation | Un-conjugated |
Alternate Names | Really interesting new gene 4 protein; ABC17; TAP1*0102N; ATP-binding cassette sub-family B member 2; TAP1N; RING4; Antigen peptide transporter 1; ABCB2; APT1; Peptide transporter involved in antigen processing 1; PSF-1; D6S114E; PSF1; Peptide transporter PSF1; Peptide transporter TAP1; Peptide supply factor 1 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
Preservative | 0.05% Sodium azide |
Stabilizer | 5% BSA |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | TAP1 |
Gene Full Name | transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) |
Background | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2014] |
Function | Involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. Also acts as a molecular scaffold for the final stage of MHC class I folding, namely the binding of peptide. Nascent MHC class I molecules associate with TAP via tapasin. Inhibited by the covalent attachment of herpes simplex virus ICP47 protein, which blocks the peptide-binding site of TAP. Inhibited by human cytomegalovirus US6 glycoprotein, which binds to the lumenal side of the TAP complex and inhibits peptide translocation by specifically blocking ATP-binding to TAP1 and prevents the conformational rearrangement of TAP induced by peptide binding. Inhibited by human adenovirus E3-19K glycoprotein, which binds the TAP complex and acts as a tapasin inhibitor, preventing MHC class I/TAP association. Expression of TAP1 is down-regulated by human Epstein-Barr virus vIL-10 protein, thereby affecting the transport of peptides into the endoplasmic reticulum and subsequent peptide loading by MHC class I molecules. [UniProt] |
Cellular Localization | Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=The transmembrane segments seem to form a pore in the membrane. [UniProt] |
Calculated MW | 87 kDa |
Images (1) Click the Picture to Zoom In