ARG59133

anti-TAP1 antibody

Datasheet

Ordering Information

Package

Price (USD)

50 μg

325.00

Add to cart

Datasheet

Overview

Product Description	Rabbit Polyclonal antibody recognizes TAP1
Tested Reactivity	Hu
Tested Application	IHC-P
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Target Name	TAP1
Antigen Species	Human
Immunogen	Synthetic peptide corresponding to aa. 438-471 of Human TAP1. (RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN)
Conjugation	Un-conjugated
Alternate Names	Really interesting new gene 4 protein; ABC17; TAP1*0102N; ATP-binding cassette sub-family B member 2; TAP1N; RING4; Antigen peptide transporter 1; ABCB2; APT1; Peptide transporter involved in antigen processing 1; PSF-1; D6S114E; PSF1; Peptide transporter PSF1; Peptide transporter TAP1; Peptide supply factor 1

Application Instructions

Application Suggestion

Tested Application	Dilution
IHC-P	0.5 - 1 µg/ml

Application Note

IHC-P: Antigen Retrieval: By heat mediation.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form	Liquid
Purification	Affinity purification with immunogen.
Buffer	0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative	0.05% Sodium azide
Stabilizer	5% BSA
Concentration	0.5 mg/ml
Storage Instruction	For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note	For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links	GeneID: 6890 Human TAP1 Swiss-port # Q03518 Human Antigen peptide transporter 1
Gene Symbol	TAP1
Gene Full Name	transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
Background	The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2014]
Function	Involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. Also acts as a molecular scaffold for the final stage of MHC class I folding, namely the binding of peptide. Nascent MHC class I molecules associate with TAP via tapasin. Inhibited by the covalent attachment of herpes simplex virus ICP47 protein, which blocks the peptide-binding site of TAP. Inhibited by human cytomegalovirus US6 glycoprotein, which binds to the lumenal side of the TAP complex and inhibits peptide translocation by specifically blocking ATP-binding to TAP1 and prevents the conformational rearrangement of TAP induced by peptide binding. Inhibited by human adenovirus E3-19K glycoprotein, which binds the TAP complex and acts as a tapasin inhibitor, preventing MHC class I/TAP association. Expression of TAP1 is down-regulated by human Epstein-Barr virus vIL-10 protein, thereby affecting the transport of peptides into the endoplasmic reticulum and subsequent peptide loading by MHC class I molecules. [UniProt]
Cellular Localization	Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=The transmembrane segments seem to form a pore in the membrane. [UniProt]
Calculated MW	87 kDa