ARG59127
anti-SOX5 antibody
anti-SOX5 antibody for Western blot and Human,Mouse,Rat,Pig
Overview
Product Description | Rabbit Polyclonal antibody recognizes SOX5 |
---|---|
Tested Reactivity | Hu, Ms, Rat, Pig |
Predict Reactivity | Bov |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | SOX5 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to aa. 495-528 of Human SOX5. (EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS) |
Conjugation | Un-conjugated |
Alternate Names | L-SOX5B; L-SOX5; Transcription factor SOX-5; L-SOX5F |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
Preservative | 0.05% Sodium azide |
Stabilizer | 5% BSA |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | SOX5 |
Gene Full Name | SRY (sex determining region Y)-box 5 |
Background | This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Function | Binds specifically to the DNA sequence 5'-AACAAT-3'. Activates transcription of COL2A1 and AGC1 in vitro. [UniProt] |
Cellular Localization | Nucleus. [UniProt] |
Calculated MW | 84 kDa |
Images (2) Click the Picture to Zoom In
-
ARG59127 anti-SOX5 antibody WB image
Western blot: 50 µg of Rat liver, Rat testis, Rat brain, 40 µg of HeLa and A549 lysates stained with ARG59127 anti-SOX5 antibody at 0.5 µg/ml dilution.
-
ARG59127 anti-SOX5 antibody WB image
Western blot: 50 µg of sample under reducing conditions. Mouse spleen and Mouse thymus lysates stained with ARG59127 anti-SOX5 antibody at 0.5 µg/ml dilution, overnight at 4°C.