ARG41311
anti-SOX12 antibody
anti-SOX12 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SOX12 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Dog, Gpig, Hrs, Pig |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SOX12 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the C-terminal region of Human SOX12. (within the following region: DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY) |
| Conjugation | Un-conjugated |
| Alternate Names | Transcription factor SOX-12; SOX22; Protein SOX-22 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Dog: 92%; Guinea pig: 85%; Horse: 92%; Mouse: 92%; Pig: 92%; Rat: 92% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Jurkat | ||||
| Observed Size | ~ 34 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | SOX12 |
| Gene Full Name | SRY (sex determining region Y)-box 12 |
| Background | Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains, and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types. [provided by RefSeq, Jan 2013] |
| Function | Binds to the sequence 5'-AACAAT-3'. [UniProt] |
| Cellular Localization | Nucleus. [UniProt] |
| Calculated MW | 34 kDa |
Images (1) Click the Picture to Zoom In
-
ARG41311 anti-SOX12 antibody WB image
Western blot: Jurkat cell lysate stained with ARG41311 anti-SOX12 antibody at 0.2 - 1 µg/ml dilution.
