ARG59640
anti-SLC25A20 antibody
anti-SLC25A20 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SLC25A20 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Sheep, Zfsh |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SLC25A20 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the C-terminal region of Human SLC25A20. (within the following region: GGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSL) |
| Conjugation | Un-conjugated |
| Alternate Names | CAC; CACT; Carnitine/acylcarnitine translocase; Solute carrier family 25 member 20; Mitochondrial carnitine/acylcarnitine carrier protein |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # O43772 Human Mitochondrial carnitine/acylcarnitine carrier protein |
|---|---|
| Gene Symbol | SLC25A20 |
| Gene Full Name | solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 |
| Background | This gene product is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space. This protein mediates the transport of acylcarnitines into mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. Mutations in this gene are associated with carnitine-acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants. [provided by RefSeq, Jul 2008] |
| Function | Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. [UniProt] |
| Cellular Localization | Mitochondrion inner membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 33 kDa |
Images (1) Click the Picture to Zoom In
-
ARG59640 anti-SLC25A20 antibody WB image
Western blot: Jurkat cell lysate stained with ARG59640 anti-SLC25A20 antibody at 0.2 - 1 µg/ml dilution.
