ARG40519
anti-SGLT2 antibody
anti-SGLT2 antibody for Western blot and Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SGLT2 |
|---|---|
| Tested Reactivity | Ms |
| Predict Reactivity | Hu, Rat, Cow, Dog, Gpig, Hrs, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SGLT2 |
| Antigen Species | Mouse |
| Immunogen | Synthetic peptide from Mouse SGLT2. (within the following region: SSTCYQPRPDSYHLLRDPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQRC) |
| Conjugation | Un-conjugated |
| Alternate Names | Na; Solute carrier family 5 member 2; Sodium/glucose cotransporter 2; SGLT2; Low affinity sodium-glucose cotransporter |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Rabbit: 93%; Rat: 93% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | SLC5A2 |
| Gene Full Name | solute carrier family 5 (sodium/glucose cotransporter), member 2 |
| Background | This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria. Two transcript variants, one protein-coding and one not, have been found for this gene. [provided by RefSeq, Feb 2015] |
| Function | Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules. [UniProt] |
| Cellular Localization | Membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 73 kDa |
Images (1) Click the Picture to Zoom In
-
ARG40519 anti-SGLT2 antibody WB image
Western blot: Mouse thymus lysate stained with ARG40519 anti-SGLT2 antibody at 1 ug/ml dilution.
