ARG41304
anti-REG1 alpha antibody
anti-REG1 alpha antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes REG1 alpha |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | REG1 alpha |
| Antigen Species | Human |
| Immunogen | Synthetic peptide located within the following region: SLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN |
| Conjugation | Un-conjugated |
| Alternate Names | Islet cells regeneration factor; Regenerating protein I alpha; Lithostathine-1-alpha; Islet of Langerhans regenerating protein; PSPS1; ICRF; REG-1-alpha; Regenerating islet-derived protein 1-alpha; P19; PSP; Pancreatic thread protein; PSPS; REG; Pancreatic stone protein; PTP |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Human fetal liver | ||||
| Observed Size | 13 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | REG1A |
| Gene Full Name | regenerating islet-derived 1 alpha |
| Background | This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq, Jul 2008] |
| Function | Might act as an inhibitor of spontaneous calcium carbonate precipitation. May be associated with neuronal sprouting in brain, and with brain and pancreas regeneration. [UniProt] |
| Cellular Localization | Secreted. [UniProt] |
| Calculated MW | 19 kDa |
| PTM | The composition of the O-linked carbohydrate on Thr-27 is complex and varied. In the crystallographic structure, the attached sugar appears to be N-acetylglucosamine, typical of an intracellular protein, rather than N-acetylgalactosamine. [UniProt] |
Images (1) Click the Picture to Zoom In
-
ARG41304 anti-REG1 alpha antibody WB image
Western blot: Human fetal liver lysate stained with ARG41304 anti-REG1 alpha antibody at 1 µg/ml dilution.
