ARG59337
anti-RAB14 antibody
anti-RAB14 antibody for Western blot and Human,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes RAB14 |
|---|---|
| Tested Reactivity | Hu, Rat |
| Predict Reactivity | Hm |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | RAB14 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 124-153 of Human RAB14. (NKADLEAQRDVTYEEAKQFAEENGLLFLEA) |
| Conjugation | Un-conjugated |
| Alternate Names | RAB-14; Ras-related protein Rab-14; FBP |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | RAB14 |
| Gene Full Name | RAB14, member RAS oncogene family |
| Background | RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 [PubMed 15004230]).[supplied by OMIM, Mar 2009] |
| Function | Involved in membrane trafficking between the Golgi complex and endosomes during early embryonic development. Regulates the Golgi to endosome transport of FGFR-containing vesicles during early development, a key process for developing basement membrane and epiblast and primitive endoderm lineages during early postimplantation development. May act by modulating the kinesin KIF16B-cargo association to endosomes (By similarity). Regulates, together with its guanine nucleotide exchange factor DENND6A, the specific endocytic transport of ADAM10, N-cadherin/CDH2 shedding and cell-cell adhesion. [UniProt] |
| Cellular Localization | Recycling endosome. Early endosome membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus, trans-Golgi network membrane; Lipid-anchor; Cytoplasmic side. Cytoplasmic vesicle, phagosome. Note=Recruited to recycling endosomes by DENND6A (PubMed:22595670). Recruited to phagosomes containing S.aureus or M.tuberculosis (PubMed:21255211). [UniProt] |
| Calculated MW | 24 kDa |
Images (1) Click the Picture to Zoom In
-
ARG59337 anti-RAB14 antibody WB image
Western blot: 50 ug of Rat brain, 40 ug of Raji and 40 ug of SMMC-7721 whole cell lysates stained with ARG59337 anti-RAB14 antibody at 0.5 ug/ml dilution.
