ARG56505
anti-Prostaglandin I Synthase antibody
anti-Prostaglandin I Synthase antibody for Immunoprecipitation,Western blot and Human,Bovine,Sheep
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Prostaglandin I Synthase |
|---|---|
| Tested Reactivity | Hu, Bov, Sheep |
| Species Does Not React With | Rat |
| Tested Application | IP, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Prostaglandin I Synthase |
| Antigen Species | Bovine |
| Immunogen | Synthetic peptide around aa. 299-329 of Bovine Prostaglandin I Synthase. (LLKNPEALAAVRGELETVLLGAEQPISQMTT) |
| Conjugation | Un-conjugated |
| Alternate Names | PTGI; CYP8A1; Prostaglandin I2 synthase; EC 5.3.99.4; PGIS; Prostacyclin synthase; CYP8 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | PTGIS |
| Gene Full Name | prostaglandin I2 (prostacyclin) synthase |
| Background | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis. [provided by RefSeq, Jul 2008] |
| Function | Catalyzes the isomerization of prostaglandin H2 to prostacyclin (= prostaglandin I2). [UniProt] |
| Calculated MW | 57 kDa |
