ARG40846
anti-Properdin antibody
anti-Properdin antibody for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Properdin |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Properdin |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human Properdin. (MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR) |
| Conjugation | Un-conjugated |
| Alternate Names | PFC; PFD; BFD; PROPERDIN; Complement factor P; Properdin |
Application Instructions
| Application Suggestion |
|
||||||||
|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | CFP |
| Gene Full Name | complement factor properdin |
| Background | This gene encodes a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified.[provided by RefSeq, Feb 2009] |
| Function | A positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes. [UniProt] |
| Cellular Localization | Secreted. [UniProt] |
| Calculated MW | 51 kDa |
Images (8) Click the Picture to Zoom In
-
ARG40846 anti-Properdin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human cholangiocarcinoma tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40846 anti-Properdin antibody at 1 µg/ml, overnight at 4°C.
-
ARG40846 anti-Properdin antibody WB image
Western blot: 50 µg of samples under reducing conditions. Human placenta, U-937, Rat brain and Mouse brain lysates stained with ARG40846 anti-Properdin antibody at 0.5 µg/ml, overnight at 4°C.
-
ARG40846 anti-Properdin antibody FACS image
Flow Cytometry: THP-1 cells were blocked with 10% normal goat serum and then stained with ARG40846 anti-Properdin antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG40846 anti-Properdin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human liver cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40846 anti-Properdin antibody at 1 µg/ml, overnight at 4°C.
-
ARG40846 anti-Properdin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human placenta tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40846 anti-Properdin antibody at 1 µg/ml, overnight at 4°C.
-
ARG40846 anti-Properdin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse kidney tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40846 anti-Properdin antibody at 1 µg/ml, overnight at 4°C.
-
ARG40846 anti-Properdin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat liver tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40846 anti-Properdin antibody at 1 µg/ml, overnight at 4°C.
-
ARG40846 anti-Properdin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat intestine tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40846 anti-Properdin antibody at 1 µg/ml, overnight at 4°C.
