ARG59034
anti-Peroxiredoxin 4 antibody
anti-Peroxiredoxin 4 antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Peroxiredoxin 4 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, ICC/IF, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Peroxiredoxin 4 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 178-208 of Human Peroxiredoxin 4 (SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK). |
| Conjugation | Un-conjugated |
| Alternate Names | EC 1.11.1.15; AOE372; Antioxidant enzyme AOE372; HEL-S-97n; Thioredoxin-dependent peroxide reductase A0372; Peroxiredoxin IV; Peroxiredoxin-4; PRX-4; Prx-IV; Thioredoxin peroxidase AO372; AOE37-2 |
Application Instructions
| Application Suggestion |
|
||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | PRDX4 |
| Gene Full Name | peroxiredoxin 4 |
| Background | The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB. [provided by RefSeq, Jul 2008] |
| Function | Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation. [UniProt] |
| Cellular Localization | Cytoplasm. Secreted. [UniProt] |
| Calculated MW | 31 kDa |
Images (7) Click the Picture to Zoom In
-
ARG59034 anti-Peroxiredoxin 4 antibody ICC image
Immunocytochemistry: A549 cells stained with ARG59034 anti-Peroxiredoxin 4 antibody.
-
ARG59034 anti-Peroxiredoxin 4 antibody ICC/IF image
Immunofluorescence: A549 cells were blocked with 10% goat serum and then stained with ARG59034 anti-Peroxiredoxin 4 antibody (green) at 2 µg/ml dilution, overnight at 4°C. DAPI (blue) for nuclear staining.
-
ARG59034 anti-Peroxiredoxin 4 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse brain tissue stained with ARG59034 anti-Peroxiredoxin 4 antibody.
-
ARG59034 anti-Peroxiredoxin 4 antibody WB image
Western blot: 50 µg of Rat brain, 50 µg of Mouse brain and 40 µg of HeLa lysates stained with ARG59034 anti-Peroxiredoxin 4 antibody at 0.5 µg/ml dilution.
-
ARG59034 anti-Peroxiredoxin 4 antibody FACS image
Flow Cytometry: MCF-7 cells were blocked with 10% normal goat serum and then stained with ARG59034 anti-Peroxiredoxin 4 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG59034 anti-Peroxiredoxin 4 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat brain tissue stained with ARG59034 anti-Peroxiredoxin 4 antibody.
-
ARG59034 anti-Peroxiredoxin 4 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human tonsil tissue stained with ARG59034 anti-Peroxiredoxin 4 antibody.
