ARG40151
anti-PUS1 antibody
anti-PUS1 antibody for Western blot and Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes PUS1 |
|---|---|
| Tested Reactivity | Ms |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | PUS1 |
| Antigen Species | Mouse |
| Immunogen | Synthetic peptide corresponding to a region of Mouse PUS1. (within the following region: GGWVWEETEHPAKRVKGGEDEEPPRKLPKRKIVLLMAYSGKGYHGMQRNL) |
| Conjugation | Un-conjugated |
| Alternate Names | tRNA pseudouridine synthase A, mitochondrial; tRNA-uridine isomerase I; 38-40; tRNA pseudouridine; EC 5.4.99.12; tRNA pseudouridylate synthase I; MLASA1 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Mouse kidney |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q9WU56 Mouse tRNA pseudouridine synthase A, mitochondrial |
|---|---|
| Gene Symbol | PUS1 |
| Gene Full Name | pseudouridylate synthase 1 |
| Background | This gene encodes a pseudouridine synthase that converts uridine to pseudouridine once it has been incorporated into an RNA molecule. The encoded enzyme may play an essential role in tRNA function and in stabilizing the secondary and tertiary structure of many RNAs. A mutation in this gene has been linked to mitochondrial myopathy and sideroblastic anemia. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Sep 2009] |
| Function | Converts specific uridines to PSI in a number of tRNA substrates. Acts on positions 27/28 in the anticodon stem and also positions 34 and 36 in the anticodon of an intron containing tRNA. Involved in regulation of nuclear receptor activity possibly through pseudouridylation of SRA1 RNA (By similarity). [UniProt] |
| Cellular Localization | Isoform 1: Mitochondrion. Isoform 2: Nucleus. [UniProt] |
| Calculated MW | 47 kDa |
Images (1) Click the Picture to Zoom In
-
ARG40151 anti-PUS1 antibody WB image
Western blot: Mouse kidney lysate stained with ARG40151 anti-PUS1 antibody at 0.2 - 1 µg/ml dilution.
