ARG59267

anti-PIAS3 antibody

anti-PIAS3 antibody for Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes PIAS3
Tested Reactivity Hu, Ms, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name PIAS3
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human PIAS3. (QRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRF)
Conjugation Un-conjugated
Alternate Names Protein inhibitor of activated STAT protein 3; E3 SUMO-protein ligase PIAS3; EC 6.3.2.-; ZMIZ5

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 70 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 10401 Human PIAS3

GeneID: 229615 Mouse PIAS3

GeneID: 83614 Rat PIAS3

Gene Symbol PIAS3
Gene Full Name protein inhibitor of activated STAT, 3
Background This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2008]
Function Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway and the steroid hormone signaling pathway. Involved in regulating STAT3 signaling via inhibiting STAT3 DNA-binding and suppressing cell growth. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation. Sumoylates CCAR2 which promotes its interaction with SIRT1. [UniProt]
Cellular Localization Cytoplasm. Nucleus. Nucleus speckle. Note=Colocalizes with MITF in the nucleus. Colocalizes with GFI1 in nuclear dots. Colocalizes with SUMO1 in nuclear granules. [UniProt]
Calculated MW 68 kDa
PTM Sumoylated. [UniProt]

Images (1) Click the Picture to Zoom In

  • ARG59267 anti-PIAS3 antibody WB image

    Western blot: 50 µg of samples under reducing conditions. HeLa, U-87MG, COLO-320, HepG2, Rat brain and NIH/3T3 lysates stained with ARG59267 anti-PIAS3 antibody at 0.5 µg/ml, overnight at 4°C.