ARG41101
anti-PDGF BB antibody
anti-PDGF BB antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes PDGF BB |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Predict Reactivity | Cow, Dog, Gpig, Sheep |
| Tested Application | IHC-P, WB |
| Specificity | This antibody react to full length and proform of PDGF BB but not mature form of PDGF B. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | PDGF BB |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region (a.a. 2-51) of Human PDGF B. (within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD) |
| Conjugation | Un-conjugated |
| Alternate Names | SIS; Becaplermin; Platelet-derived growth factor subunit B; IBGC5; PDGF subunit B; c-sis; SSV; PDGF-2; Proto-oncogene c-Sis; Platelet-derived growth factor beta polypeptide; PDGF2; Platelet-derived growth factor B chain |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Sheep: 100% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | 293T | ||||||
| Observed Size | 31 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | PDGFB |
| Gene Full Name | platelet-derived growth factor beta polypeptide |
| Background | The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 17, at sites where this gene and that for collagen type 1, alpha 1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2013] |
| Function | Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA (By similarity). [UniProt] |
| Cellular Localization | Secreted. Note=Released by platelets upon wounding. [UniProt] |
| Calculated MW | 27 kDa |
Images (2) Click the Picture to Zoom In
-
ARG41101 anti-PDGF B antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human uterus tissue stained with ARG41101 anti-PDGF B antibody at 5 µg/ml dilution.
-
ARG41101 anti-PDGF B antibody WB image
Western blot: 293T cell lysate stained with ARG41101 anti-PDGF B antibody at 0.2 - 1 µg/ml dilution.
