ARG40156

anti-OPRL1 / Nociceptin Receptor antibody

anti-OPRL1 / Nociceptin Receptor antibody for Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes OPRL1 / Nociceptin Receptor
Tested Reactivity Hu
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name OPRL1 / Nociceptin Receptor
Antigen Species Human
Immunogen Synthetic peptide around the C-terminal region of Human OPRL1. (within the following region: ALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKD)
Conjugation Un-conjugated
Alternate Names Nociceptin receptor; ORL1; Orphanin FQ receptor; NOCIR; Kappa-type 3 opioid receptor; OOR; KOR-3

Application Instructions

Application Suggestion
Tested Application Dilution
WB1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 4987 Human OPRL1

Swiss-port # P41146 Human Nociceptin receptor

Gene Symbol OPRL1
Gene Full Name opiate receptor-like 1
Background The protein encoded by this gene is a G protein-coupled receptor whose expression can be induced by phytohemagglutinin. The encoded integral membrane protein is a receptor for the 17 aa neuropeptide nociceptin/orphanin FQ. This gene may be involved in the regulation of numerous brain activities, particularly instinctive and emotional behaviors. A promoter for this gene also functions as a promoter for another gene, regulator of G-protein signalling 19 (RGS19), located on the opposite strand. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2011]
Function G-protein coupled opioid receptor that functions as receptor for the endogenous neuropeptide nociceptin. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling via G proteins mediates inhibition of adenylate cyclase activity and calcium channel activity. Arrestins modulate signaling via G proteins and mediate the activation of alternative signaling pathways that lead to the activation of MAP kinases. Plays a role in modulating nociception and the perception of pain. Plays a role in the regulation of locomotor activity by the neuropeptide nociceptin. [UniProt]
Cellular Localization Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle. Note=Ligand binding leads to receptor internalization into cytoplasmic vesicles, decreasing the amount of available receptor at the cell surface. Internalization requires phosphorylation at Ser-363. Can recycle to the cell membrane. [UniProt]
Calculated MW 41 kDa
PTM Phosphorylation at Ser-363 requires GRK3. [UniProt]

Images (1) Click the Picture to Zoom In

  • ARG40156 anti-OPRL1 / Nociceptin Receptor antibody WB image

    Western blot: Human 786-0 whole cell lysate stained with ARG40156 anti-OPRL1 / Nociceptin Receptor antibody at 1 µg/ml dilution.