ARG58758
anti-NR5A1 antibody
anti-NR5A1 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes NR5A1 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Sheep |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | NR5A1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human NR5A1. (within the following sequence: AVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGP) |
| Conjugation | Un-conjugated |
| Alternate Names | SRXY3; Nuclear receptor subfamily 5 group A member 1; POF7; SF-1; SPGF8; FTZ1; FTZF1; SF1; Steroid hormone receptor Ad4BP; Fushi tarazu factor homolog 1; AD4BP; Adrenal 4-binding protein; ELP; Steroidogenic factor 1; STF-1 |
Application Instructions
| Predict Reactivity Note | Predicted homology based on immunogen sequence: Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Mouse: 79%; Rabbit: 85%; Rat: 92%; Sheep: 85% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | HepG2 |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | NR5A1 |
| Gene Full Name | nuclear receptor subfamily 5, group A, member 1 |
| Background | The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect. [provided by RefSeq, Jul 2008] |
| Function | Transcriptional activator. Seems to be essential for sexual differentiation and formation of the primary steroidogenic tissues. Binds to the Ad4 site found in the promoter region of steroidogenic P450 genes such as CYP11A, CYP11B and CYP21B. Also regulates the AMH/Muellerian inhibiting substance gene as well as the AHCH and STAR genes. 5'-YCAAGGYC-3' and 5'-RRAGGTCA-3' are the consensus sequences for the recognition by NR5A1. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional avtivity. Binds phosphatidylcholine (By similarity). Binds phospholipids with a phosphatidylinositol (PI) headgroup, in particular PI(3,4)P2 and PI(3,4,5)P3. Activated by the phosphorylation of NR5A1 by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. [UniProt] |
| Calculated MW | 52 kDa |
| PTM | Acetylation stimulates the transcriptional activity. Sumoylation reduces CDK7-mediated phosphorylation on Ser-203. Phosphorylated on Ser-203 by CDK7. This phosphorylation promotes transcriptional activity. [UniProt] |
Images (1) Click the Picture to Zoom In
-
ARG58758 anti-NR5A1 antibody WB image
Western blot: HepG2 cell lysate stained with ARG58758 anti-NR5A1 antibody at 0.2 - 1 µg/ml dilution.
