ARG40508
anti-NONO / p54nrb antibody
anti-NONO / p54nrb antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes NONO / p54nrb |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Predict Reactivity | Bov |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | NONO / p54nrb |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 1-35 of Human NONO / p54nrb. (MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ) |
| Conjugation | Un-conjugated |
| Alternate Names | Non-POU domain-containing octamer-binding protein; p54nrb; NonO protein; DNA-binding p52/p100 complex, 52 kDa subunit; P54NRB; NRB54; p54; NMT55; 55 kDa nuclear protein; 54 kDa nuclear RNA- and DNA-binding protein; P54; PPP1R114; nrb |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | NONO |
| Gene Full Name | non-POU domain containing, octamer-binding |
| Background | This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. [provided by RefSeq, Feb 2009] |
| Function | DNA- and RNA binding protein, involved in several nuclear processes. Binds the conventional octamer sequence in double-stranded DNA. Also binds single-stranded DNA and RNA at a site independent of the duplex site. Involved in pre-mRNA splicing, probably as a heterodimer with SFPQ. Interacts with U5 snRNA, probably by binding to a purine-rich sequence located on the 3' side of U5 snRNA stem 1b. Together with PSPC1, required for the formation of nuclear paraspeckles. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs. The SFPQ-NONO heteromer may be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1. The SFPQ-NONO heteromer may be involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. In vitro, the complex strongly stimulates DNA end joining, binds directly to the DNA substrates and cooperates with the Ku70/G22P1-Ku80/XRCC5 (Ku) dimer to establish a functional preligation complex. NONO is involved in transcriptional regulation. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional avtivity. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. [UniProt] |
| Cellular Localization | Nucleus. Nucleus, nucleolus. Nucleus speckle. Note=Detected in punctate subnuclear structures often located adjacent to splicing speckles, called paraspeckles. [UniProt] |
| Calculated MW | 54 kDa |
| PTM | The N-terminus is blocked. [UniProt] |
Images (4) Click the Picture to Zoom In
-
ARG40508 anti-NONO / p54nrb antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse brain stained with ARG40508 anti-NONO / p54nrb antibody at 1 µg/ml dilution.
-
ARG40508 anti-NONO / p54nrb antibody WB image
Western blot: Rat brain, Human placenta and PANC whole cell lysates stained with ARG40508 anti-NONO / p54nrb antibody at 0.5 µg/ml dilution.
-
ARG40508 anti-NONO / p54nrb antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat intestine stained with ARG40508 anti-NONO / p54nrb antibody at 1 µg/ml dilution.
-
ARG40508 anti-NONO / p54nrb antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human intestinal cancer tissue stained with ARG40508 anti-NONO / p54nrb antibody at 1 µg/ml dilution.
