ARG40424
anti-NME3 / nm23 H3 antibody
anti-NME3 / nm23 H3 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes NME3 / nm23 H3 |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | NME3 / nm23 H3 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human NME3 / nm23 H3. (within the following region: CLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKL) |
| Conjugation | Un-conjugated |
| Alternate Names | Nucleoside diphosphate kinase C; NDPK-C; NDPKC; NM23-H3; Nucleoside diphosphate kinase 3; NDP kinase 3; EC 2.7.4.6; DR-nm23; nm23-H3; NM23H3; c371H6.2; NDK 3 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Observed Size | ~ 19 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | NME3 |
| Gene Full Name | NME/NM23 nucleoside diphosphate kinase 3 |
| Function | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis. [UniProt] |
| Calculated MW | 19 kDa |
Images (1) Click the Picture to Zoom In
-
ARG40424 anti-NME3 / nm23 H3 antibody WB image
Western blot: 786-O whole cell lysate stained with ARG40424 anti-NME3 / nm23 H3 antibody.
