ARG40424
anti-NME3 / nm23 H3 antibody
anti-NME3 / nm23 H3 antibody for Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes NME3 / nm23 H3 |
---|---|
Tested Reactivity | Hu |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | NME3 / nm23 H3 |
Antigen Species | Human |
Immunogen | Synthetic peptide around the N-terminal region of Human NME3 / nm23 H3. (within the following region: CLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKL) |
Conjugation | Un-conjugated |
Alternate Names | Nucleoside diphosphate kinase C; NDPK-C; NDPKC; NM23-H3; Nucleoside diphosphate kinase 3; NDP kinase 3; EC 2.7.4.6; DR-nm23; nm23-H3; NM23H3; c371H6.2; NDK 3 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
Observed Size | ~ 19 kDa |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | NME3 |
Gene Full Name | NME/NM23 nucleoside diphosphate kinase 3 |
Function | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis. [UniProt] |
Calculated MW | 19 kDa |
Images (1) Click the Picture to Zoom In