ARG59460
anti-NDRG2 antibody
anti-NDRG2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes NDRG2 |
|---|---|
| Tested Reactivity | Ms, Rat |
| Predict Reactivity | Hu |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | NDRG2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 210-247 of Human NDRG2. (NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER) |
| Conjugation | Un-conjugated |
| Alternate Names | Protein Syld709613; N-myc downstream-regulated gene 2 protein; SYLD; Protein NDRG2 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | NDRG2 |
| Gene Full Name | NDRG family member 2 |
| Background | This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2008] |
| Function | Contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron differentiation. [UniProt] |
| Cellular Localization | Cytoplasm. Cytoplasm, perinuclear region. Cell projection, growth cone. Note=In neurons, seems to concentrate at axonal growth cone. Perinuclear in neurons (By similarity). [UniProt] |
| Calculated MW | 41 kDa |
Images (3) Click the Picture to Zoom In
-
ARG59460 anti-NDRG2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse brain stained with ARG59460 anti-NDRG2 antibody.
-
ARG59460 anti-NDRG2 antibody WB image
Western blot: 50 µg of Rat brain and Mouse brain lysates stained with ARG59460 anti-NDRG2 antibody at 0.5 µg/ml dilution.
-
ARG59460 anti-NDRG2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat brain stained with ARG59460 anti-NDRG2 antibody.
