ARG59437
anti-NAA15 / NARG1 antibody
anti-NAA15 / NARG1 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes NAA15 / NARG1 |
|---|---|
| Tested Reactivity | Hu, Ms |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | NAA15 / NARG1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 244-287 of Human NAA15 / NARG1. (ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY) |
| Conjugation | Un-conjugated |
| Alternate Names | Protein tubedown-1; N-terminal acetyltransferase; Tbdn100; NARG1; TBDN; TBDN100; NATH; N-alpha-acetyltransferase 15, NatA auxiliary subunit; NMDA receptor-regulated protein 1; Ga19; Gastric cancer antigen Ga19; NAT1P |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q9BXJ9 Human N-alpha-acetyltransferase 15, NatA auxiliary subunit |
|---|---|
| Gene Symbol | NAA15 |
| Gene Full Name | N(alpha)-acetyltransferase 15, NatA auxiliary subunit |
| Background | This gene encodes a protein of unknown function. However, similarity to proteins in yeast and other species suggests that this protein may be an N-acetyltransferase. [provided by RefSeq, Jul 2008] |
| Function | Auxillary subunit of the N-terminal acetyltransferase A (NatA) complex which displays alpha (N-terminal) acetyltransferase activity. The NAT activity may be important for vascular, hematopoietic and neuronal growth and development. Required to control retinal neovascularization in adult ocular endothelial cells. In complex with XRCC6 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter. [UniProt] |
| Cellular Localization | Cytoplasm. Nucleus. Note=Mainly cytoplasmic, nuclear in some cases. Present in the free cytosolic and cytoskeleton-bound polysomes, but not in the membrane-bound polysomes. [UniProt] |
| Calculated MW | 101 kDa |
| PTM | Cleaved by caspases during apoptosis, resulting in a stable 35 kDa fragment. [UniProt] |
Images (2) Click the Picture to Zoom In
-
ARG59437 anti-NAA15 / NARG1 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse intestine stained with ARG59437 anti-NAA15 / NARG1 antibody at 1 µg/ml dilution.
-
ARG59437 anti-NAA15 / NARG1 antibody WB image
Western blot: 293T whole cell lysate stained with ARG59437 anti-NAA15 / NARG1 antibody at 0.5 µg/ml dilution.
