ARG40826
anti-MDR1 / P Glycoprotein 1 antibody
anti-MDR1 / P Glycoprotein 1 antibody for Flow cytometry,ICC/IF,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MDR1 / P Glycoprotein 1 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat |
| Tested Application | FACS, ICC/IF, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MDR1 / P Glycoprotein 1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human P Glycoprotein 1. (QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY) |
| Conjugation | Un-conjugated |
| Alternate Names | PGY1; ABC20; P-GP; ATP-binding cassette sub-family B member 1; Multidrug resistance protein 1; CD antigen CD243; GP170; CLCS; CD243; MDR1; EC 3.6.3.44; P-glycoprotein 1 |
Application Instructions
| Application Suggestion |
|
||||||||
|---|---|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | ABCB1 |
| Gene Full Name | ATP-binding cassette, sub-family B (MDR/TAP), member 1 |
| Background | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. [provided by RefSeq, Jul 2008] |
| Function | Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells. [UniProt] |
| Cellular Localization | Cell membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 141 kDa |
Images (3) Click the Picture to Zoom In
-
ARG40826 anti-MDR1 / P Glycoprotein 1 antibody ICC/IF image
Immunofluorescence: U2OS cells were blocked with 10% goat serum and then stained with ARG40826 anti-MDR1 / P Glycoprotein 1 antibody (green) at 2 µg/ml dilution, overnight at 4°C. DAPI (blue) for nuclear staining.
-
ARG40826 anti-MDR1 / P Glycoprotein 1 antibody WB image
Western blot: 50 µg of samples under reducing conditions. THP-1 and A375 whole cell lysates stained with ARG40826 anti-MDR1 / P Glycoprotein 1 antibody at 0.5 µg/ml, overnight at 4°C.
-
ARG40826 anti-MDR1 / P Glycoprotein 1 antibody FACS image
Flow Cytometry: U2OS cells were blocked with 10% normal goat serum and then stained with ARG40826 anti-MDR1 / P Glycoprotein 1 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
