ARG59046

anti-MDM4 / MDMX antibody

anti-MDM4 / MDMX antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse

Overview

Product Description Rabbit Polyclonal antibody recognizes MDM4 / MDMX
Tested Reactivity Hu, Ms
Predict Reactivity Bov, Hrs, Mk, Rb
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name MDM4 / MDMX
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 35-72 of Human MDMX (KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH).
Conjugation Un-conjugated
Alternate Names Double minute 4 protein; p53-binding protein Mdm4; MDMX; Protein Mdm4; Mdm2-like p53-binding protein; HDMX; MRP1; Protein Mdmx

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: By heat mediation.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 17248 Mouse MDM4

GeneID: 4194 Human MDM4

Swiss-port # O15151 Human Protein Mdm4

Swiss-port # O35618 Mouse Protein Mdm4

Gene Symbol MDM4
Gene Full Name MDM4, p53 regulator
Background This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Feb 2011]
Function Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions. [UniProt]
Cellular Localization Nucleus. [UniProt]
Calculated MW 55 kDa
PTM Phosphorylated. Phosphorylation at Ser-367 promotes interaction with YWHAG and subsequent ubiquitination and degradation. Phosphorylation at Ser-342 also induces ubiquitination and degradation but to a lower extent.

Ubiquitinated and degraded by MDM2. Deubiquitination by USP2 on the other hand stabilizes the MDM4 protein. [UniProt]

Images (2) Click the Picture to Zoom In

  • ARG59046 anti-MDM4 / MDMX antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human lung cancer tissue stained with ARG59046 anti-MDM4 / MDMX antibody at 1 µg/ml dilution.

  • ARG59046 anti-MDM4 / MDMX antibody WB image

    Western blot: Mouse testis and 22RV1 lysates stained with ARG59046 anti-MDM4 / MDMX antibody at 0.5 µg/ml dilution.