ARG59249
anti-MCM8 antibody
anti-MCM8 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MCM8 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Hm |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MCM8 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 809-840 of Human MCM8. (IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM) |
| Conjugation | Un-conjugated |
| Alternate Names | DNA helicase MCM8; dJ967N21.5; POF10; EC 3.6.4.12; C20orf154; Minichromosome maintenance 8 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Observed Size | 94 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | MCM8 |
| Gene Full Name | minichromosome maintenance 8 homologous recombination repair factor |
| Background | The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the mini-chromosome maintenance proteins is a key component of the pre-replication complex and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the mini-chromosome maintenance proteins. The encoded protein may interact with other mini-chromosome maintenance proteins and play a role in DNA replication. This gene may be associated with length of reproductive lifespan and menopause. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2013] |
| Function | Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8-MCM9 complex probably acts as a hexameric helicase downstream of the Fanconi anemia proteins BRCA2 and RAD51 and is required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart. May also play a non-essential for DNA replication: may be involved in the activation of the prereplicative complex (pre-RC) during G(1) phase by recruiting CDC6 to the origin recognition complex (ORC). Binds chromatin throughout the cell cycle. [UniProt] |
| Cellular Localization | Nucleus. Localizes to nuclear foci and colocalizes with RAD51. [UniProt] |
| Calculated MW | 94 kDa |
Images (1) Click the Picture to Zoom In
-
ARG59249 anti-MCM8 antibody WB image
Western blot: 40 µg of A549, SW620, HeLa, PANC and HepG2 whole cell lysates stained with ARG59249 anti-MCM8 antibody at 0.5 µg/ml dilution.
